Lineage for d1k3tb2 (1k3t B:165-333)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506899Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 506900Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 506901Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 506941Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 507096Species Trypanosoma cruzi [TaxId:5693] [75483] (3 PDB entries)
  8. 507098Domain d1k3tb2: 1k3t B:165-333 [72025]
    Other proteins in same PDB: d1k3ta1, d1k3tb1, d1k3tc1, d1k3td1

Details for d1k3tb2

PDB Entry: 1k3t (more details), 1.95 Å

PDB Description: Structure of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi Complexed with Chalepin, a Coumarin Derivative Inhibitor

SCOP Domain Sequences for d1k3tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3tb2 d.81.1.1 (B:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

SCOP Domain Coordinates for d1k3tb2:

Click to download the PDB-style file with coordinates for d1k3tb2.
(The format of our PDB-style files is described here.)

Timeline for d1k3tb2: