Lineage for d1k3tb2 (1k3t B:165-333)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193860Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 193861Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 193862Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 193870Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (13 species)
  7. 193986Species Trypanosoma cruzi [TaxId:5693] [75483] (1 PDB entry)
  8. 193988Domain d1k3tb2: 1k3t B:165-333 [72025]
    Other proteins in same PDB: d1k3ta1, d1k3tb1, d1k3tc1, d1k3td1

Details for d1k3tb2

PDB Entry: 1k3t (more details), 1.95 Å

PDB Description: Structure of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi Complexed with Chalepin, a Coumarin Derivative Inhibitor
PDB Compounds: (B:)

SCOP Domain Sequences for d1k3tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3tb2 d.81.1.1 (B:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

SCOP Domain Coordinates for d1k3tb2:

Click to download the PDB-style file with coordinates for d1k3tb2.
(The format of our PDB-style files is described here.)

Timeline for d1k3tb2: