SCOPe 2.02: Domain d1jt0c2: 1jt0 C:73-189

Lineage for d1jt0c2 (1jt0 C:73-189)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries)
   Uniprot P23217

8. Domain d1jt0c2: 1jt0 C:73-189 [71855]
   Other proteins in same PDB: d1jt0a1, d1jt0b1, d1jt0c1, d1jt0d1
   protein/DNA complex; complexed with so4

Details for d1jt0c2

PDB Entry: 1jt0, 2.9 Å

PDB Description: crystal structure of a cooperative qacr-dna complex

PDB Compounds: (C:) hypothetical transcriptional regulator in qaca 5'region

SCOPe Domain Sequences for d1jt0c2:

Sequence; same for both SEQRES and ATOM records:

>d1jt0c2 a.121.1.1 (C:73-189) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflnglskh

Timeline for d1jt0c2:

• d1jt0c2 first appeared in SCOP 1.61
  
• d1jt0c2 appears in SCOPe 2.01
  
• d1jt0c2 appears in SCOPe 2.03
  
• d1jt0c2 appears in the current release, SCOPe 2.08