Lineage for d1jt0b2 (1jt0 B:73-189)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1096810Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1096811Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 1096812Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)
  6. 1096841Protein Multidrug binding protein QacR [69107] (1 species)
  7. 1096842Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries)
    Uniprot P23217
  8. 1096904Domain d1jt0b2: 1jt0 B:73-189 [71853]
    Other proteins in same PDB: d1jt0a1, d1jt0b1, d1jt0c1, d1jt0d1
    protein/DNA complex; complexed with so4

Details for d1jt0b2

PDB Entry: 1jt0 (more details), 2.9 Å

PDB Description: crystal structure of a cooperative qacr-dna complex
PDB Compounds: (B:) hypothetical transcriptional regulator in qaca 5'region

SCOPe Domain Sequences for d1jt0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jt0b2 a.121.1.1 (B:73-189) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflnglskh

SCOPe Domain Coordinates for d1jt0b2:

Click to download the PDB-style file with coordinates for d1jt0b2.
(The format of our PDB-style files is described here.)

Timeline for d1jt0b2: