Lineage for d1jb4b_ (1jb4 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543396Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 2543418Protein Nuclear transport factor-2 (NTF2) [54432] (4 species)
  7. 2543433Species Norway rat (Rattus norvegicus) [TaxId:10116] [54433] (11 PDB entries)
    Uniprot P61972
  8. 2543441Domain d1jb4b_: 1jb4 B: [71627]
    mutant

Details for d1jb4b_

PDB Entry: 1jb4 (more details), 2.23 Å

PDB Description: crystal structure of ntf2 m102e mutant
PDB Compounds: (B:) nuclear transport factor 2

SCOPe Domain Sequences for d1jb4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb4b_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpiweqigssfinhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqefllknindawvctndmfrlal
hnf

SCOPe Domain Coordinates for d1jb4b_:

Click to download the PDB-style file with coordinates for d1jb4b_.
(The format of our PDB-style files is described here.)

Timeline for d1jb4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jb4a_