Lineage for d1jb4b_ (1jb4 B:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
Superfamily d.17.4: NTF2-like [54427] (31 families) 
has a beta-alpha(2)-beta insertion after the main helix
Family d.17.4.2: NTF2-like [54431] (6 proteins) Protein Nuclear transport factor-2 (NTF2) [54432] (4 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [54433] (11 PDB entries)
Uniprot P61972
Domain d1jb4b_: 1jb4 B: [71627]
mutant
Details for d1jb4b_
PDB Entry: 1jb4 (more details), 2.23 Å
PDB Description: crystal structure of ntf2 m102e mutant
PDB Compounds: (B:) nuclear transport factor 2SCOPe Domain Sequences for d1jb4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb4b_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpiweqigssfinhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqefllknindawvctndmfrlal
hnf
SCOPe Domain Coordinates for d1jb4b_:
Click to download the PDB-style file with coordinates for d1jb4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jb4b_:
- d1jb4b_ first appeared in SCOP 1.61
- d1jb4b_ appears in SCOPe 2.06
- d1jb4b_ appears in the current release, SCOPe 2.08
View in 3D
