Lineage for d1jb4b_ (1jb4 B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190011Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 190149Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 190170Family d.17.4.2: NTF2-like [54431] (3 proteins)
  6. 190179Protein Nuclear transport factor-2 (NTF2) [54432] (3 species)
  7. 190192Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (9 PDB entries)
  8. 190204Domain d1jb4b_: 1jb4 B: [71627]

Details for d1jb4b_

PDB Entry: 1jb4 (more details), 2.23 Å

PDB Description: crystal structure of ntf2 m102e mutant

SCOP Domain Sequences for d1jb4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb4b_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiweqigssfinhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqefllknindawvctndmfrlal
hnf

SCOP Domain Coordinates for d1jb4b_:

Click to download the PDB-style file with coordinates for d1jb4b_.
(The format of our PDB-style files is described here.)

Timeline for d1jb4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jb4a_