| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.17: Cystatin-like [54402] (5 superfamilies) |
Superfamily d.17.4: NTF2-like [54427] (4 families) ![]() |
| Family d.17.4.2: NTF2-like [54431] (3 proteins) |
| Protein Nuclear transport factor-2 (NTF2) [54432] (3 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (9 PDB entries) |
| Domain d1jb4a_: 1jb4 A: [71626] |
PDB Entry: 1jb4 (more details), 2.23 Å
SCOP Domain Sequences for d1jb4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb4a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiweqigssfinhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqefllknindawvctndmfrlal
hnf
Timeline for d1jb4a_: