Lineage for d1iw7l2 (1iw7 L:50-172)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265174Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 265175Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 265176Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 265177Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 265186Species Thermus thermophilus [TaxId:274] [75595] (1 PDB entry)
  8. 265190Domain d1iw7l2: 1iw7 L:50-172 [71481]
    Other proteins in same PDB: d1iw7a1, d1iw7b1, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f_, d1iw7k1, d1iw7l1, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p_
    complexed with mg, pb

Details for d1iw7l2

PDB Entry: 1iw7 (more details), 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution

SCOP Domain Sequences for d1iw7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw7l2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOP Domain Coordinates for d1iw7l2:

Click to download the PDB-style file with coordinates for d1iw7l2.
(The format of our PDB-style files is described here.)

Timeline for d1iw7l2: