| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() |
| Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
| Protein RNA polymerase alpha subunit [56555] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75595] (1 PDB entry) |
| Domain d1iw7l2: 1iw7 L:50-172 [71481] Other proteins in same PDB: d1iw7a1, d1iw7b1, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f_, d1iw7k1, d1iw7l1, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p_ complexed with mg, pb |
PDB Entry: 1iw7 (more details), 2.6 Å
SCOP Domain Sequences for d1iw7l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iw7l2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs
Timeline for d1iw7l2: