| Class g: Small proteins [56992] (90 folds) |
| Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
| Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
| Protein Ascidian trypsin inhibitor [75678] (1 species) |
| Species Sea squirt (Halocynthia roretzi) [TaxId:7729] [75679] (1 PDB entry) |
| Domain d1iw4a_: 1iw4 A: [71469] |
PDB Entry: 1iw4 (more details)
SCOPe Domain Sequences for d1iw4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iw4a_ g.68.1.1 (A:) Ascidian trypsin inhibitor {Sea squirt (Halocynthia roretzi) [TaxId: 7729]}
ahmdctefnplcrcnkmlgdlicavigdakeehrnmcalccehpggfeysngpce
Timeline for d1iw4a_: