SCOPe 2.01: Domain d1iw4a_: 1iw4 A:

Lineage for d1iw4a_ (1iw4 A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Ascidian trypsin inhibitor [75678] (1 species)

7. Species Sea squirt (Halocynthia roretzi) [TaxId:7729] [75679] (1 PDB entry)

8. Domain d1iw4a_: 1iw4 A: [71469]

Details for d1iw4a_

PDB Entry: 1iw4

PDB Description: solution structure of ascidian trypsin inhibitor

PDB Compounds: (A:) trypsin inhibitor

SCOPe Domain Sequences for d1iw4a_:

Sequence; same for both SEQRES and ATOM records:

>d1iw4a_ g.68.1.1 (A:) Ascidian trypsin inhibitor {Sea squirt (Halocynthia roretzi) [TaxId: 7729]}
ahmdctefnplcrcnkmlgdlicavigdakeehrnmcalccehpggfeysngpce

Timeline for d1iw4a_:

• d1iw4a_ first appeared in SCOP 1.61
  
• d1iw4a_ appears in SCOP 1.75
  
• d1iw4a_ appears in SCOPe 2.02
  
• d1iw4a_ appears in the current release, SCOPe 2.08