Lineage for d1iw4a_ (1iw4 A:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203954Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 203955Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 203956Family g.15.1.1: Animal Kazal-type inhibitors [57468] (9 proteins)
  6. 203957Protein Ascidian trypsin inhibitor [75678] (1 species)
  7. 203958Species Sea squirt (Halocynthia roretzi) [TaxId:7729] [75679] (1 PDB entry)
  8. 203959Domain d1iw4a_: 1iw4 A: [71469]

Details for d1iw4a_

PDB Entry: 1iw4 (more details)

PDB Description: solution structure of ascidian trypsin inhibitor

SCOP Domain Sequences for d1iw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw4a_ g.15.1.1 (A:) Ascidian trypsin inhibitor {Sea squirt (Halocynthia roretzi)}
ahmdctefnplcrcnkmlgdlicavigdakeehrnmcalccehpggfeysngpce

SCOP Domain Coordinates for d1iw4a_:

Click to download the PDB-style file with coordinates for d1iw4a_.
(The format of our PDB-style files is described here.)

Timeline for d1iw4a_: