PDB entry 1iw4

View 1iw4 on RCSB PDB site
Description: solution structure of ascidian trypsin inhibitor
Deposited on 2002-04-19, released 2002-08-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-28, with a file datestamp of 2002-08-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1iw4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iw4A (A:)
    ahmdctefnplcrcnkmlgdlicavigdakeehrnmcalccehpggfeysngpce