SCOP 1.63: Domain d1ivub1: 1ivu B:212-628

Lineage for d1ivub1 (1ivu B:212-628)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family)

5. Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)

6. Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [50003] (10 PDB entries)

8. Domain d1ivub1: 1ivu B:212-628 [71447]
   Other proteins in same PDB: d1ivua2, d1ivua3, d1ivub2, d1ivub3
   complexed with cu

Details for d1ivub1

PDB Entry: 1ivu, 1.9 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: initial intermediate in topaquinone biogenesis

SCOP Domain Sequences for d1ivub1:

Sequence; same for both SEQRES and ATOM records:

>d1ivub1 b.30.2.1 (B:212-628) Copper amine oxidase, domain 3 (catalytic) {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

Timeline for d1ivub1:

• d1ivub1 first appeared in SCOP 1.61
  
• d1ivub1 appears in SCOP 1.65
  
• d1ivub1 appears in the current release, SCOPe 2.08