| Class g: Small proteins [56992] (61 folds) |
| Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily) folds around 4Fe-4S cluster |
Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) ![]() |
| Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein) |
| Protein HIPIP (high potential iron protein) [57654] (6 species) |
| Species Thermochromatium tepidum [TaxId:1050] [57660] (2 PDB entries) |
| Domain d1iuaa_: 1iua A: [71438] complexed with fs4, so4 |
PDB Entry: 1iua (more details), 0.8 Å
SCOP Domain Sequences for d1iuaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iuaa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Thermochromatium tepidum}
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag
Timeline for d1iuaa_: