Lineage for d1iuaa_ (1iua A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343805Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 343806Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 343807Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 343808Protein HIPIP (high potential iron protein) [57654] (7 species)
  7. 343840Species Thermochromatium tepidum [TaxId:1050] [57660] (2 PDB entries)
  8. 343841Domain d1iuaa_: 1iua A: [71438]
    complexed with fs4, so4

Details for d1iuaa_

PDB Entry: 1iua (more details), 0.8 Å

PDB Description: ultra-high resolution structure of hipip from thermochromatium tepidum

SCOP Domain Sequences for d1iuaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iuaa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Thermochromatium tepidum}
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag

SCOP Domain Coordinates for d1iuaa_:

Click to download the PDB-style file with coordinates for d1iuaa_.
(The format of our PDB-style files is described here.)

Timeline for d1iuaa_: