Lineage for d1it6b_ (1it6 B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 263837Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 263838Superfamily d.159.1: Metallo-dependent phosphatases [56300] (5 families) (S)
  5. 263873Family d.159.1.3: Protein serine/threonine phosphatase [56310] (3 proteins)
  6. 263879Protein Protein phosphatase-1 (PP-1) [56311] (2 species)
  7. 263880Species Human (Homo sapiens) [TaxId:9606] [64430] (2 PDB entries)
  8. 263883Domain d1it6b_: 1it6 B: [71408]
    complexed with cyu, mn

Details for d1it6b_

PDB Entry: 1it6 (more details), 2 Å

PDB Description: crystal structure of the complex between calyculin a and the catalytic subunit of protein phosphatase 1

SCOP Domain Sequences for d1it6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it6b_ d.159.1.3 (B:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens)}
lnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOP Domain Coordinates for d1it6b_:

Click to download the PDB-style file with coordinates for d1it6b_.
(The format of our PDB-style files is described here.)

Timeline for d1it6b_: