Lineage for d1it6a_ (1it6 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679954Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1679980Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 1679991Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (5 PDB entries)
    Uniprot P36873
  8. 1679993Domain d1it6a_: 1it6 A: [71407]
    complexed with cyu, mn

Details for d1it6a_

PDB Entry: 1it6 (more details), 2 Å

PDB Description: crystal structure of the complex between calyculin a and the catalytic subunit of protein phosphatase 1
PDB Compounds: (A:) serine/threonine protein phosphatase 1 gamma (pp1-gamma) catalytic subunit

SCOPe Domain Sequences for d1it6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it6a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}
lnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d1it6a_:

Click to download the PDB-style file with coordinates for d1it6a_.
(The format of our PDB-style files is described here.)

Timeline for d1it6a_: