Lineage for d1it6a_ (1it6 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198175Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
  4. 198176Superfamily d.159.1: Metallo-dependent phosphatases [56300] (4 families) (S)
  5. 198211Family d.159.1.3: Protein serine/threonine phosphatase [56310] (3 proteins)
  6. 198217Protein Protein phosphatase-1 (PP-1) [56311] (2 species)
  7. 198218Species Human (Homo sapiens) [TaxId:9606] [64430] (2 PDB entries)
  8. 198220Domain d1it6a_: 1it6 A: [71407]

Details for d1it6a_

PDB Entry: 1it6 (more details), 2 Å

PDB Description: crystal structure of the complex between calyculin a and the catalytic subunit of protein phosphatase 1

SCOP Domain Sequences for d1it6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it6a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens)}
lnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOP Domain Coordinates for d1it6a_:

Click to download the PDB-style file with coordinates for d1it6a_.
(The format of our PDB-style files is described here.)

Timeline for d1it6a_: