Lineage for d1iqua1 (1iqu A:172-416)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216266Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 216267Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) (S)
  5. 216268Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)
  6. 216269Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. 216275Species Thermus thermophilus [TaxId:274] [69083] (2 PDB entries)
  8. 216277Domain d1iqua1: 1iqu A:172-416 [71280]
    Other proteins in same PDB: d1iqua2
    complexed with thymine
    complexed with fad, po4, tdr

Details for d1iqua1

PDB Entry: 1iqu (more details), 2.2 Å

PDB Description: Crystal structure of photolyase-thymine complex

SCOP Domain Sequences for d1iqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqua1 a.99.1.1 (A:172-416) C-terminal domain of DNA photolyase {Thermus thermophilus}
lplpepgeeaalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweae
rrggegarkwvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktg
vplvdaamrelhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgw
qwagglgvdaapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrryl
rlard

SCOP Domain Coordinates for d1iqua1:

Click to download the PDB-style file with coordinates for d1iqua1.
(The format of our PDB-style files is described here.)

Timeline for d1iqua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iqua2