Lineage for d1inqa1 (1inq A:182-275)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1759808Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1760095Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
    Uniprot P01901 22-299
  8. 1760148Domain d1inqa1: 1inq A:182-275 [71247]
    Other proteins in same PDB: d1inqa2, d1inqb_
    complexed with dms

Details for d1inqa1

PDB Entry: 1inq (more details), 2.2 Å

PDB Description: Structure of Minor Histocompatibility Antigen peptide, H13a, complexed to H2-Db
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1inqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inqa1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwe

SCOPe Domain Coordinates for d1inqa1:

Click to download the PDB-style file with coordinates for d1inqa1.
(The format of our PDB-style files is described here.)

Timeline for d1inqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1inqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1inqb_