Lineage for d1inqa1 (1inq A:182-275)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 158975Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (9 PDB entries)
  8. 158984Domain d1inqa1: 1inq A:182-275 [71247]
    Other proteins in same PDB: d1inqa2

Details for d1inqa1

PDB Entry: 1inq (more details), 2.2 Å

PDB Description: Structure of Minor Histocompatibility Antigen peptide, H13a, complexed to H2-Db

SCOP Domain Sequences for d1inqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inqa1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwe

SCOP Domain Coordinates for d1inqa1:

Click to download the PDB-style file with coordinates for d1inqa1.
(The format of our PDB-style files is described here.)

Timeline for d1inqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1inqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1inqb1