Lineage for d1ijkb_ (1ijk B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048333Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1048350Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88864] (4 PDB entries)
  8. 1048353Domain d1ijkb_: 1ijk B: [71235]
    Other proteins in same PDB: d1ijka_, d1ijkc_
    complexed with the von Willebrand factor a1 domain
    mutant

Details for d1ijkb_

PDB Entry: 1ijk (more details), 2.6 Å

PDB Description: the von willebrand factor mutant (i546v) a1 domain-botrocetin complex
PDB Compounds: (B:) Botrocetin

SCOPe Domain Sequences for d1ijkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijkb_ d.169.1.1 (B:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

SCOPe Domain Coordinates for d1ijkb_:

Click to download the PDB-style file with coordinates for d1ijkb_.
(The format of our PDB-style files is described here.)

Timeline for d1ijkb_: