SCOP 1.61: Domain d1ijkb_: 1ijk B:

Lineage for d1ijkb_ (1ijk B:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (18 proteins)

6. Protein Snake coagglutinin [56446] (5 species)

7. Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [56449] (2 PDB entries)

8. Domain d1ijkb_: 1ijk B: [71235]
   Other proteins in same PDB: d1ijka_

Details for d1ijkb_

PDB Entry: 1ijk, 2.6 Å

PDB Description: the von willebrand factor mutant (i546v) a1 domain-botrocetin complex

SCOP Domain Sequences for d1ijkb_:

Sequence; same for both SEQRES and ATOM records:

>d1ijkb_ d.169.1.1 (B:) Snake coagglutinin {Jararaca (Bothrops jararaca), botrocetin}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

Timeline for d1ijkb_:

• d1ijkb_ is new in SCOP 1.61
  
• d1ijkb_ appears in SCOP 1.63
  
• d1ijkb_ appears in the current release, SCOPe 2.08