Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) |
Family d.169.1.1: C-type lectin domain [56437] (18 proteins) |
Protein Snake coagglutinin [56446] (5 species) |
Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [56449] (2 PDB entries) |
Domain d1ijkb_: 1ijk B: [71235] Other proteins in same PDB: d1ijka_ |
PDB Entry: 1ijk (more details), 2.6 Å
SCOP Domain Sequences for d1ijkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijkb_ d.169.1.1 (B:) Snake coagglutinin {Jararaca (Bothrops jararaca), botrocetin} dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc aqknpfvcksppp
Timeline for d1ijkb_: