Lineage for d1hpud1 (1hpu D:363-550)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195918Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
  4. 195919Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (1 family) (S)
  5. 195920Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
  6. 195921Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (1 species)
  7. 195922Species Escherichia coli [TaxId:562] [55819] (5 PDB entries)
  8. 195928Domain d1hpud1: 1hpu D:363-550 [70985]
    Other proteins in same PDB: d1hpua2, d1hpub2, d1hpuc2, d1hpud2

Details for d1hpud1

PDB Entry: 1hpu (more details), 1.85 Å

PDB Description: 5'-nucleotidase (closed form), complex with ampcp

SCOP Domain Sequences for d1hpud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpud1 d.114.1.1 (D:363-550) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvye
pkgevswq

SCOP Domain Coordinates for d1hpud1:

Click to download the PDB-style file with coordinates for d1hpud1.
(The format of our PDB-style files is described here.)

Timeline for d1hpud1: