Lineage for d1hpua2 (1hpu A:26-362)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198175Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
  4. 198176Superfamily d.159.1: Metallo-dependent phosphatases [56300] (4 families) (S)
  5. 198198Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (1 protein)
  6. 198199Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (1 species)
  7. 198200Species Escherichia coli [TaxId:562] [56309] (5 PDB entries)
  8. 198203Domain d1hpua2: 1hpu A:26-362 [70980]
    Other proteins in same PDB: d1hpua1, d1hpub1, d1hpuc1, d1hpud1

Details for d1hpua2

PDB Entry: 1hpu (more details), 1.85 Å

PDB Description: 5'-nucleotidase (closed form), complex with ampcp

SCOP Domain Sequences for d1hpua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpua2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli}
yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
edgkservlytpeiaenqqmisllspfqnkgkaqlev

SCOP Domain Coordinates for d1hpua2:

Click to download the PDB-style file with coordinates for d1hpua2.
(The format of our PDB-style files is described here.)

Timeline for d1hpua2: