Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (2 proteins) |
Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species) |
Species Escherichia coli [TaxId:562] [56309] (8 PDB entries) Uniprot P07024 26-550 |
Domain d1hpua2: 1hpu A:26-362 [70980] Other proteins in same PDB: d1hpua1, d1hpub1, d1hpuc1, d1hpud1 complexed with a12, mn |
PDB Entry: 1hpu (more details), 1.85 Å
SCOPe Domain Sequences for d1hpua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hpua2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw edgkservlytpeiaenqqmisllspfqnkgkaqlev
Timeline for d1hpua2: