SCOPe 2.07: Domain d1hpua2: 1hpu A:26-362

Lineage for d1hpua2 (1hpu A:26-362)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (2 proteins)

6. Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species)

7. Species Escherichia coli [TaxId:562] [56309] (8 PDB entries)
   Uniprot P07024 26-550

8. Domain d1hpua2: 1hpu A:26-362 [70980]
   Other proteins in same PDB: d1hpua1, d1hpub1, d1hpuc1, d1hpud1
   complexed with a12, mn

Details for d1hpua2

PDB Entry: 1hpu, 1.85 Å

PDB Description: 5'-nucleotidase (closed form), complex with ampcp

PDB Compounds: (A:) 5'-nucleotidase

SCOPe Domain Sequences for d1hpua2:

Sequence; same for both SEQRES and ATOM records:

>d1hpua2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]}
yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
edgkservlytpeiaenqqmisllspfqnkgkaqlev

Timeline for d1hpua2:

• d1hpua2 first appeared in SCOP 1.61
  
• d1hpua2 appears in SCOPe 2.06
  
• d1hpua2 appears in the current release, SCOPe 2.08