Lineage for d1ha7m_ (1ha7 M:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077042Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 1077067Protein Phycocyanin alpha subunit [88933] (8 species)
  7. 1077077Species Spirulina platensis [TaxId:118562] [88939] (2 PDB entries)
  8. 1077084Domain d1ha7m_: 1ha7 M: [70947]
    Other proteins in same PDB: d1ha7b_, d1ha7d_, d1ha7f_, d1ha7h_, d1ha7j_, d1ha7l_, d1ha7n_, d1ha7p_, d1ha7r_, d1ha7t_, d1ha7v_, d1ha7x_
    complexed with cyc

Details for d1ha7m_

PDB Entry: 1ha7 (more details), 2.2 Å

PDB Description: structure of a light-harvesting phycobiliprotein, c-phycocyanin from spirulina platensis at 2.2a resolution
PDB Compounds: (M:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d1ha7m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha7m_ a.1.1.3 (M:) Phycocyanin alpha subunit {Spirulina platensis [TaxId: 118562]}
mktplteavsiadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
tfelspswyiealkyikanhglsgdaateansyldyainals

SCOPe Domain Coordinates for d1ha7m_:

Click to download the PDB-style file with coordinates for d1ha7m_.
(The format of our PDB-style files is described here.)

Timeline for d1ha7m_: