Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycocyanin alpha subunit [88933] (9 species) |
Species Spirulina platensis [TaxId:118562] [88939] (2 PDB entries) |
Domain d1ha7e_: 1ha7 E: [70939] Other proteins in same PDB: d1ha7b_, d1ha7d_, d1ha7f_, d1ha7h_, d1ha7j_, d1ha7l_, d1ha7n_, d1ha7p_, d1ha7r_, d1ha7t_, d1ha7v_, d1ha7x_ complexed with cyc |
PDB Entry: 1ha7 (more details), 2.2 Å
SCOPe Domain Sequences for d1ha7e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha7e_ a.1.1.3 (E:) Phycocyanin alpha subunit {Spirulina platensis [TaxId: 118562]} mktplteavsiadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr tfelspswyiealkyikanhglsgdaateansyldyainals
Timeline for d1ha7e_: