![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
![]() | Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries) Uniprot P08095 |
![]() | Domain d1ha5d2: 1ha5 D:4108-4220 [70934] Other proteins in same PDB: d1ha5a1, d1ha5b1, d1ha5c1, d1ha5d1 complexed with zn |
PDB Entry: 1ha5 (more details), 2.82 Å
SCOPe Domain Sequences for d1ha5d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha5d2 d.15.6.1 (D:4108-4220) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]} gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievyltt
Timeline for d1ha5d2: