Lineage for d1ha5a2 (1ha5 A:1108-1220)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195863Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1195864Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1195943Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 1195944Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
    Uniprot P08095
  8. 1195959Domain d1ha5a2: 1ha5 A:1108-1220 [70928]
    Other proteins in same PDB: d1ha5a1, d1ha5b1, d1ha5c1, d1ha5d1
    complexed with zn

Details for d1ha5a2

PDB Entry: 1ha5 (more details), 2.82 Å

PDB Description: structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.
PDB Compounds: (A:) streptococcal pyogenic exotoxin a1

SCOPe Domain Sequences for d1ha5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha5a2 d.15.6.1 (A:1108-1220) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievyltt

SCOPe Domain Coordinates for d1ha5a2:

Click to download the PDB-style file with coordinates for d1ha5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ha5a2: