Lineage for d1h8tc_ (1h8t C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1334432Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1334633Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1334634Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 1334654Protein Human enterovirus B coat proteins [88635] (4 species)
  7. 1334668Species Human echovirus 11 [TaxId:12078] [74890] (3 PDB entries)
  8. 1334671Domain d1h8tc_: 1h8t C: [70922]
    complexed with doa, myr

Details for d1h8tc_

PDB Entry: 1h8t (more details), 2.9 Å

PDB Description: Echovirus 11
PDB Compounds: (C:) echovirus 11 coat protein vp3

SCOPe Domain Sequences for d1h8tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8tc_ b.121.4.1 (C:) Human enterovirus B coat proteins {Human echovirus 11 [TaxId: 12078]}
glpvintpgsnqfltsddfqspsampqfdvtpelnipgevqnlmeiaevdsvvpvnnvag
nletmdiyripvqsgnhqssqvfgfqvqpgldgvfkhtllgeilnyyahwsgsikltfvf
cgsamatgkfllayappganapksrkdamlgthiiwdvglqsscvlcipwisqthyrlvq
qdeytsagnvtcwyqtgivvpagtptscsimcfvsacndfsvrllkdtpfiqqaallq

SCOPe Domain Coordinates for d1h8tc_:

Click to download the PDB-style file with coordinates for d1h8tc_.
(The format of our PDB-style files is described here.)

Timeline for d1h8tc_: