Class b: All beta proteins [48724] (111 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (18 proteins) |
Protein Echovirus 11 [74889] (1 species) |
Species Echovirus 11 [74890] (1 PDB entry) |
Domain d1h8tc_: 1h8t C: [70922] |
PDB Entry: 1h8t (more details), 2.9 Å
SCOP Domain Sequences for d1h8tc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8tc_ b.10.1.4 (C:) Echovirus 11 {Echovirus 11} glpvintpgsnqfltsddfqspsampqfdvtpelnipgevqnlmeiaevdsvvpvnnvag nletmdiyripvqsgnhqssqvfgfqvqpgldgvfkhtllgeilnyyahwsgsikltfvf cgsamatgkfllayappganapksrkdamlgthiiwdvglqsscvlcipwisqthyrlvq qdeytsagnvtcwyqtgivvpagtptscsimcfvsacndfsvrllkdtpfiqqaallq
Timeline for d1h8tc_: