Lineage for d1h8tc_ (1h8t C:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163238Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 163239Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 163356Family b.10.1.4: Animal virus proteins [49656] (18 proteins)
  6. 163380Protein Echovirus 11 [74889] (1 species)
  7. 163381Species Echovirus 11 [74890] (1 PDB entry)
  8. 163384Domain d1h8tc_: 1h8t C: [70922]

Details for d1h8tc_

PDB Entry: 1h8t (more details), 2.9 Å

PDB Description: Echovirus 11

SCOP Domain Sequences for d1h8tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8tc_ b.10.1.4 (C:) Echovirus 11 {Echovirus 11}
glpvintpgsnqfltsddfqspsampqfdvtpelnipgevqnlmeiaevdsvvpvnnvag
nletmdiyripvqsgnhqssqvfgfqvqpgldgvfkhtllgeilnyyahwsgsikltfvf
cgsamatgkfllayappganapksrkdamlgthiiwdvglqsscvlcipwisqthyrlvq
qdeytsagnvtcwyqtgivvpagtptscsimcfvsacndfsvrllkdtpfiqqaallq

SCOP Domain Coordinates for d1h8tc_:

Click to download the PDB-style file with coordinates for d1h8tc_.
(The format of our PDB-style files is described here.)

Timeline for d1h8tc_: