Lineage for d1h8pb2 (1h8p B:68-109)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203830Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 203831Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 203907Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
  6. 203947Protein PDC-109, collagen-binding type II domain [57460] (1 species)
  7. 203948Species Cow (Bos taurus) [TaxId:9913] [57461] (2 PDB entries)
  8. 203952Domain d1h8pb2: 1h8p B:68-109 [70919]

Details for d1h8pb2

PDB Entry: 1h8p (more details), 1.82 Å

PDB Description: bull seminal plasma pdc-109 fibronectin type ii module

SCOP Domain Sequences for d1h8pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8pb2 g.14.1.2 (B:68-109) PDC-109, collagen-binding type II domain {Cow (Bos taurus)}
kcvfpfiyggkkyetctkigsmwmswcslspnydkdrawkyc

SCOP Domain Coordinates for d1h8pb2:

Click to download the PDB-style file with coordinates for d1h8pb2.
(The format of our PDB-style files is described here.)

Timeline for d1h8pb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h8pb1