PDB entry 1h8p

View 1h8p on RCSB PDB site
Description: bull seminal plasma pdc-109 fibronectin type ii module
Deposited on 2001-02-14, released 2002-04-12
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-12, with a file datestamp of 2002-04-12.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.207
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h8pA (A:)
eecvfpfvyrnrkhfdctvhgslfpwcsldadyvgrwkycaqrdyakcvfpfiyggkkye
tctkigsmwmswcslspnydkdrawkyc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h8pB (B:)
eecvfpfvyrnrkhfdctvhgslfpwcsldadyvgrwkycaqrdyakcvfpfiyggkkye
tctkigsmwmswcslspnydkdrawkyc