Lineage for d1h8pb1 (1h8p B:22-67)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063790Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1063791Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 1063888Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 1063928Protein PDC-109, collagen-binding type II domain [57460] (1 species)
  7. 1063929Species Cow (Bos taurus) [TaxId:9913] [57461] (2 PDB entries)
  8. 1063932Domain d1h8pb1: 1h8p B:22-67 [70918]
    complexed with pc

Details for d1h8pb1

PDB Entry: 1h8p (more details), 1.82 Å

PDB Description: bull seminal plasma pdc-109 fibronectin type ii module
PDB Compounds: (B:) seminal plasma protein pdc-109

SCOPe Domain Sequences for d1h8pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8pb1 g.14.1.2 (B:22-67) PDC-109, collagen-binding type II domain {Cow (Bos taurus) [TaxId: 9913]}
eecvfpfvyrnrkhfdctvhgslfpwcsldadyvgrwkycaqrdya

SCOPe Domain Coordinates for d1h8pb1:

Click to download the PDB-style file with coordinates for d1h8pb1.
(The format of our PDB-style files is described here.)

Timeline for d1h8pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h8pb2