SCOPe 2.01: Domain d1h8pa1: 1h8p A:22-67

Lineage for d1h8pa1 (1h8p A:22-67)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
   shorter two-disulfide version of a kringle module

6. Protein PDC-109, collagen-binding type II domain [57460] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57461] (2 PDB entries)

8. Domain d1h8pa1: 1h8p A:22-67 [70916]
   complexed with pc

Details for d1h8pa1

PDB Entry: 1h8p, 1.82 Å

PDB Description: bull seminal plasma pdc-109 fibronectin type ii module

PDB Compounds: (A:) seminal plasma protein pdc-109

SCOPe Domain Sequences for d1h8pa1:

Sequence; same for both SEQRES and ATOM records:

>d1h8pa1 g.14.1.2 (A:22-67) PDC-109, collagen-binding type II domain {Cow (Bos taurus) [TaxId: 9913]}
eecvfpfvyrnrkhfdctvhgslfpwcsldadyvgrwkycaqrdya

Timeline for d1h8pa1:

• d1h8pa1 first appeared in SCOP 1.61
  
• d1h8pa1 appears in SCOP 1.75
  
• d1h8pa1 appears in SCOPe 2.02
  
• d1h8pa1 appears in the current release, SCOPe 2.08