SCOPe 2.07: Domain d1h59a_: 1h59 A:

Lineage for d1h59a_ (1h59 A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
   Uniprot P05019 49-110

8. Domain d1h59a_: 1h59 A: [70880]
   Other proteins in same PDB: d1h59b_
   complex with IGFBP-5

Details for d1h59a_

PDB Entry: 1h59, 2.1 Å

PDB Description: complex of igfbp-5 with igf-i

PDB Compounds: (A:) insulin-like growth factor ia

SCOPe Domain Sequences for d1h59a_:

Sequence, based on SEQRES records:

>d1h59a_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyc
apl

Sequence, based on observed residues (ATOM records):

>d1h59a_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
petlcgaelvdalqfvcgdrgfyfnkptgytgivdeccfrscdlrrlemycapl

Timeline for d1h59a_:

• d1h59a_ first appeared in SCOP 1.61
  
• d1h59a_ appears in SCOPe 2.06
  
• d1h59a_ appears in the current release, SCOPe 2.08