SCOPe 2.07: Domain d1h59b_: 1h59 B:

Lineage for d1h59b_ (1h59 B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins)
   Pfam PF00757; Pfam PF14843; Pfam PF15913

6. Protein Insulin-like growth factor-binding protein-5 (IGFBP-5) [57186] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57187] (2 PDB entries)

8. Domain d1h59b_: 1h59 B: [70881]
   Other proteins in same PDB: d1h59a_
   complex with IGF

Details for d1h59b_

PDB Entry: 1h59, 2.1 Å

PDB Description: complex of igfbp-5 with igf-i

PDB Compounds: (B:) insulin-like growth factor binding protein 5

SCOPe Domain Sequences for d1h59b_:

Sequence; same for both SEQRES and ATOM records:

>d1h59b_ g.3.9.1 (B:) Insulin-like growth factor-binding protein-5 (IGFBP-5) {Human (Homo sapiens) [TaxId: 9606]}
salaegqscgvytercaqglrclprqdeekplhallhgrgvclne

Timeline for d1h59b_:

• d1h59b_ first appeared in SCOP 1.61
  
• d1h59b_ appears in SCOPe 2.06
  
• d1h59b_ appears in the current release, SCOPe 2.08