Lineage for d1h59b_ (1h59 B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635726Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 2635727Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
  6. 2635754Protein Insulin-like growth factor-binding protein-5 (IGFBP-5) [57186] (1 species)
  7. 2635755Species Human (Homo sapiens) [TaxId:9606] [57187] (2 PDB entries)
  8. 2635756Domain d1h59b_: 1h59 B: [70881]
    Other proteins in same PDB: d1h59a_
    complex with IGF

Details for d1h59b_

PDB Entry: 1h59 (more details), 2.1 Å

PDB Description: complex of igfbp-5 with igf-i
PDB Compounds: (B:) insulin-like growth factor binding protein 5

SCOPe Domain Sequences for d1h59b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h59b_ g.3.9.1 (B:) Insulin-like growth factor-binding protein-5 (IGFBP-5) {Human (Homo sapiens) [TaxId: 9606]}
salaegqscgvytercaqglrclprqdeekplhallhgrgvclne

SCOPe Domain Coordinates for d1h59b_:

Click to download the PDB-style file with coordinates for d1h59b_.
(The format of our PDB-style files is described here.)

Timeline for d1h59b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h59a_