Lineage for d1h4ld_ (1h4l D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739685Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1739686Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1739687Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1739688Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species)
  7. 1739689Species Human (Homo sapiens) [TaxId:9606] [74740] (5 PDB entries)
    Uniprot Q15078 145-294
  8. 1739698Domain d1h4ld_: 1h4l D: [70873]
    Other proteins in same PDB: d1h4la_, d1h4lb_

Details for d1h4ld_

PDB Entry: 1h4l (more details), 2.65 Å

PDB Description: structure and regulation of the cdk5-p25(nck5a) complex
PDB Compounds: (D:) cyclin-dependent kinase 5 activator

SCOPe Domain Sequences for d1h4ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4ld_ a.74.1.1 (D:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens) [TaxId: 9606]}
stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
lmsskmlqinadphyftqvfsdlknes

SCOPe Domain Coordinates for d1h4ld_:

Click to download the PDB-style file with coordinates for d1h4ld_.
(The format of our PDB-style files is described here.)

Timeline for d1h4ld_: