Lineage for d1h4lb_ (1h4l B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930198Protein Cyclin-dependent PK, CDK5 [88857] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1930199Species Human (Homo sapiens) [TaxId:9606] [88858] (5 PDB entries)
    Uniprot Q00535
  8. 1930209Domain d1h4lb_: 1h4l B: [70872]
    Other proteins in same PDB: d1h4ld_, d1h4le_

Details for d1h4lb_

PDB Entry: 1h4l (more details), 2.65 Å

PDB Description: structure and regulation of the cdk5-p25(nck5a) complex
PDB Compounds: (B:) cell division protein kinase 5

SCOPe Domain Sequences for d1h4lb_:

Sequence, based on SEQRES records: (download)

>d1h4lb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
qkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkhk
nivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrn
vlhrdlkpqnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklyst
sidmwsagcifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypm
ypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfs

Sequence, based on observed residues (ATOM records): (download)

>d1h4lb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
qkyeklekiygtvfkaknretheivalkrvrldgvpssalreicllkelkhknivrlhdv
lhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkp
qnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsag
cifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslv
nvvpklnatgrdllqnllkcnpvqrisaeealqhpyfs

SCOPe Domain Coordinates for d1h4lb_:

Click to download the PDB-style file with coordinates for d1h4lb_.
(The format of our PDB-style files is described here.)

Timeline for d1h4lb_: