Lineage for d1h4hd_ (1h4h D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 165029Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 165041Protein Xylanase II [49979] (13 species)
  7. 165049Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries)
  8. 165059Domain d1h4hd_: 1h4h D: [70868]

Details for d1h4hd_

PDB Entry: 1h4h (more details), 1.9 Å

PDB Description: oligosaccharide-binding to family 11 xylanases: both covalent intermediate and mutant-product complexes display 2,5b conformations at the active-centre

SCOP Domain Sequences for d1h4hd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4hd_ b.29.1.11 (D:) Xylanase II {Bacillus agaradhaerens}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplvayyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnplst

SCOP Domain Coordinates for d1h4hd_:

Click to download the PDB-style file with coordinates for d1h4hd_.
(The format of our PDB-style files is described here.)

Timeline for d1h4hd_: