Lineage for d1h4hb_ (1h4h B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) 
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) Protein Xylanase II [49979] (13 species) Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries) 
Domain d1h4hb_: 1h4h B: [70866]
Details for d1h4hb_
PDB Entry: 1h4h (more details), 1.9 Å
PDB Description: oligosaccharide-binding to family 11 xylanases: both covalent intermediate and mutant-product complexes display 2,5b conformations at the active-centre
SCOP Domain Sequences for d1h4hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4hb_ b.29.1.11 (B:) Xylanase II {Bacillus agaradhaerens}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplvayyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnplsti
SCOP Domain Coordinates for d1h4hb_:
Click to download the PDB-style file with coordinates for d1h4hb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h4hb_:
- d1h4hb_ is new in SCOP 1.61
- d1h4hb_ appears in SCOP 1.63
- d1h4hb_ appears in the current release, SCOPe 2.08
View in 3D
