SCOPe 2.01: Domain d1h19a2: 1h19 A:1-208

Lineage for d1h19a2 (1h19 A:1-208)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.98: Leukotriene A4 hydrolase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Leukotriene A4 hydrolase N-terminal domain [63737] (1 family)

5. Family b.98.1.1: Leukotriene A4 hydrolase N-terminal domain [63738] (1 protein)

6. Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63740] (15 PDB entries)
   Uniprot P09960

8. Domain d1h19a2: 1h19 A:1-208 [70848]
   Other proteins in same PDB: d1h19a1, d1h19a3
   complexed with acy, imd, yb, zn

Details for d1h19a2

PDB Entry: 1h19, 2.1 Å

PDB Description: structure of [e271q]leukotriene a4 hydrolase

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d1h19a2:

Sequence; same for both SEQRES and ATOM records:

>d1h19a2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
pedpsrkiykfiqkvpipcylialvvga

Timeline for d1h19a2:

• d1h19a2 first appeared in SCOP 1.61
  
• d1h19a2 appears in SCOP 1.75
  
• d1h19a2 appears in SCOPe 2.02
  
• d1h19a2 appears in the current release, SCOPe 2.08