Lineage for d1h19a2 (1h19 A:1-208)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172550Fold b.98: Leukotriene A4 hydrolase N-terminal domain [63736] (1 superfamily)
  4. 172551Superfamily b.98.1: Leukotriene A4 hydrolase N-terminal domain [63737] (1 family) (S)
  5. 172552Family b.98.1.1: Leukotriene A4 hydrolase N-terminal domain [63738] (1 protein)
  6. 172553Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 172554Species Human (Homo sapiens) [TaxId:9606] [63740] (2 PDB entries)
  8. 172556Domain d1h19a2: 1h19 A:1-208 [70848]
    Other proteins in same PDB: d1h19a1, d1h19a3

Details for d1h19a2

PDB Entry: 1h19 (more details), 2.1 Å

PDB Description: structure of [e271q]leukotriene a4 hydrolase

SCOP Domain Sequences for d1h19a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h19a2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens)}
peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
pedpsrkiykfiqkvpipcylialvvga

SCOP Domain Coordinates for d1h19a2:

Click to download the PDB-style file with coordinates for d1h19a2.
(The format of our PDB-style files is described here.)

Timeline for d1h19a2: