Lineage for d1gzhb1 (1gzh B:1724-1866)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1157252Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1157253Superfamily c.15.1: BRCT domain [52113] (5 families) (S)
    Pfam PF00533
  5. 1157329Family c.15.1.4: 53BP1 [75148] (1 protein)
  6. 1157330Protein 53BP1 [75149] (1 species)
  7. 1157331Species Human (Homo sapiens) [TaxId:9606] [75150] (2 PDB entries)
  8. 1157336Domain d1gzhb1: 1gzh B:1724-1866 [70808]
    Other proteins in same PDB: d1gzha_, d1gzhc_
    complexed with so4, zn

Details for d1gzhb1

PDB Entry: 1gzh (more details), 2.6 Å

PDB Description: Crystal structure of the BRCT domains of human 53BP1 bound to the p53 tumor supressor
PDB Compounds: (B:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d1gzhb1:

Sequence, based on SEQRES records: (download)

>d1gzhb1 c.15.1.4 (B:1724-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
lnktlflgyaflltmattsdklasrsklpdgptgsseeeeefleippfnkqytesqlrag
agyiledfneaqcntayqclliadqhcrtrkyflclasgipcvshvwvhdschanqlqny
rnyllpagysleeqrildwqpre

Sequence, based on observed residues (ATOM records): (download)

>d1gzhb1 c.15.1.4 (B:1724-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
lnktlflgyaflltmattsdklasrsppfnkqytesqlragagyiledfntayqclliad
qhcrtrkyflclasgipcvshvwvhdschanqlqnyrnyllpagysleeqrildwqpre

SCOPe Domain Coordinates for d1gzhb1:

Click to download the PDB-style file with coordinates for d1gzhb1.
(The format of our PDB-style files is described here.)

Timeline for d1gzhb1: