SCOPe 2.07: Domain d1gz4d2: 1gz4 D:23-279

Lineage for d1gz4d2 (1gz4 D:23-279)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
   Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)

8. Domain d1gz4d2: 1gz4 D:23-279 [70801]
   Other proteins in same PDB: d1gz4a1, d1gz4b1, d1gz4c1, d1gz4d1
   complexed with atp, fum, mn, ttn

Details for d1gz4d2

PDB Entry: 1gz4, 2.2 Å

PDB Description: molecular mechanism of the regulation of human mitochondrial nad(p)+-dependent malic enzyme by atp and fumarate

PDB Compounds: (D:) NAD-dependent malic enzyme

SCOPe Domain Sequences for d1gz4d2:

Sequence; same for both SEQRES and ATOM records:

>d1gz4d2 c.58.1.3 (D:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky
iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
frflrkyrekyctfndd

Timeline for d1gz4d2:

• d1gz4d2 first appeared in SCOP 1.61
  
• d1gz4d2 appears in SCOPe 2.06
  
• d1gz4d2 appears in the current release, SCOPe 2.08