Lineage for d1gz4a2 (1gz4 A:23-279)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498325Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
    Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 2498332Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
  7. 2498350Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)
  8. 2498359Domain d1gz4a2: 1gz4 A:23-279 [70795]
    Other proteins in same PDB: d1gz4a1, d1gz4b1, d1gz4c1, d1gz4d1
    complexed with atp, fum, mn, ttn

Details for d1gz4a2

PDB Entry: 1gz4 (more details), 2.2 Å

PDB Description: molecular mechanism of the regulation of human mitochondrial nad(p)+-dependent malic enzyme by atp and fumarate
PDB Compounds: (A:) NAD-dependent malic enzyme

SCOPe Domain Sequences for d1gz4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gz4a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky
iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
frflrkyrekyctfndd

SCOPe Domain Coordinates for d1gz4a2:

Click to download the PDB-style file with coordinates for d1gz4a2.
(The format of our PDB-style files is described here.)

Timeline for d1gz4a2: