SCOPe 2.02: Domain d1gz4d1: 1gz4 D:280-573

Lineage for d1gz4d1 (1gz4 D:280-573)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
   includes C-terminal additional subdomains

7. Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)

8. Domain d1gz4d1: 1gz4 D:280-573 [70800]
   Other proteins in same PDB: d1gz4a2, d1gz4b2, d1gz4c2, d1gz4d2
   complexed with atp, fum, mn, ttn

Details for d1gz4d1

PDB Entry: 1gz4, 2.2 Å

PDB Description: molecular mechanism of the regulation of human mitochondrial nad(p)+-dependent malic enzyme by atp and fumarate

PDB Compounds: (D:) NAD-dependent malic enzyme

SCOPe Domain Sequences for d1gz4d1:

Sequence; same for both SEQRES and ATOM records:

>d1gz4d1 c.2.1.7 (D:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

Timeline for d1gz4d1:

• d1gz4d1 first appeared in SCOP 1.61
  
• d1gz4d1 appears in SCOPe 2.01
  
• d1gz4d1 appears in SCOPe 2.03
  
• d1gz4d1 appears in the current release, SCOPe 2.08