SCOPe 2.07: Domain d1gy1a_: 1gy1 A:

Lineage for d1gy1a_ (1gy1 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Rusticyanin [49537] (1 species)

7. Species Thiobacillus ferrooxidans [TaxId:920] [49538] (7 PDB entries)

8. Domain d1gy1a_: 1gy1 A: [70724]
   complexed with cu

Details for d1gy1a_

PDB Entry: 1gy1, 1.65 Å

PDB Description: crystal structures of ser86asp and met148leu rusticyanin

PDB Compounds: (A:) rusticyanin

SCOPe Domain Sequences for d1gy1a_:

Sequence; same for both SEQRES and ATOM records:

>d1gy1a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]}
tldttwkeatlpqvkamlqkdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkkn
ptlqipagatvdvtfintnkgfghdfditkkgppyavmpvidpivagtgfspvpkdgkfg
ytnftwhptagtyyyvcqipghaatgmfgkivvk

Timeline for d1gy1a_:

• d1gy1a_ first appeared in SCOP 1.61
  
• d1gy1a_ appears in SCOPe 2.06
  
• d1gy1a_ appears in the current release, SCOPe 2.08