Lineage for d1gy1a_ (1gy1 A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) Superfamily b.6.1: Cupredoxins [49503] (5 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Rusticyanin [49537] (1 species) Species Thiobacillus ferrooxidans [TaxId:920] [49538] (7 PDB entries) 
Domain d1gy1a_: 1gy1 A: [70724]
Details for d1gy1a_
PDB Entry: 1gy1 (more details), 1.65 Å
PDB Description: crystal structures of ser86asp and met148leu rusticyanin
SCOP Domain Sequences for d1gy1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gy1a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans}
tldttwkeatlpqvkamlqkdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkkn
ptlqipagatvdvtfintnkgfghdfditkkgppyavmpvidpivagtgfspvpkdgkfg
ytnftwhptagtyyyvcqipghaatgmfgkivvk
SCOP Domain Coordinates for d1gy1a_:
Click to download the PDB-style file with coordinates for d1gy1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gy1a_:
- d1gy1a_ is new in SCOP 1.61
- d1gy1a_ appears in SCOP 1.63
- d1gy1a_ appears in the current release, SCOPe 2.08
View in 3D
