Lineage for d1gxra1 (1gxr A:443-770)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399257Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2399258Family b.69.4.1: WD40-repeat [50979] (17 protein domains)
  6. 2399334Protein Groucho/tle1, C-terminal domain [75009] (1 species)
  7. 2399335Species Human (Homo sapiens) [TaxId:9606] [75010] (4 PDB entries)
  8. 2399336Domain d1gxra1: 1gxr A:443-770 [70722]
    Other proteins in same PDB: d1gxra2, d1gxrb2
    complexed with ca

Details for d1gxra1

PDB Entry: 1gxr (more details), 1.65 Å

PDB Description: WD40 Region of Human Groucho/TLE1
PDB Compounds: (A:) transducin-like enhancer protein 1

SCOPe Domain Sequences for d1gxra1:

Sequence, based on SEQRES records: (download)

>d1gxra1 b.69.4.1 (A:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytg
gkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlaap
tprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgasci
disndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnve
vlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssv
lscdisvddkyivtgsgdkkatvyeviy

Sequence, based on observed residues (ATOM records): (download)

>d1gxra1 b.69.4.1 (A:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytg
gkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlaap
rikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgascidi
sndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnvevl
hvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssvls
cdisvddkyivtgsgdkkatvyeviy

SCOPe Domain Coordinates for d1gxra1:

Click to download the PDB-style file with coordinates for d1gxra1.
(The format of our PDB-style files is described here.)

Timeline for d1gxra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gxra2